Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm28 Rabbit Polyclonal Antibody (Biotin)

Rbm28 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI503051, 2810480G15Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rbm28

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

AAH18373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD13 (NM_001010971) Human Recombinant Protein
TP320928 20 µg

SAMD13 (NM_001010971) Human Recombinant Protein

Sign In for Pricing
View Details
Human Pur B (PURB) activation kit by CRISPRa
GA103953 1 Kit

Human Pur B (PURB) activation kit by CRISPRa

Sign In for Pricing
View Details
PRKAR1B (NM_001164762) Human Recombinant Protein
TP328862M 100 µg

PRKAR1B (NM_001164762) Human Recombinant Protein

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF647 conjugate, 0.1mg/mL
BNC473526-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI4H1]
CF806864 100 µg

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI4H1]

Sign In for Pricing
View Details
Maltose Binding Protein / MBP-probe (R29.6), CF405S conjugate, 0.1mg/mL
BNC042847-500 1x 500 µL

Maltose Binding Protein / MBP-probe (R29.6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details