Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm28 Rabbit Polyclonal Antibody (FITC)

Rbm28 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI503051, 2810480G15Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rbm28

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

AAH18373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 3A43 Antibody
8C12274-AAT 50 µg

Cytochrome P450 3A43 Antibody

Sign In for Pricing
View Details
6-Sulfatoxy Melatonin-d4 (Major) Sodium Salt
TRC-S689052-2.5MG 2.5 mg

6-Sulfatoxy Melatonin-d4 (Major) Sodium Salt

Sign In for Pricing
View Details
C1QTNF9B (NM_001007537) Human Over-expression Lysate
LC423504 20 µg

C1QTNF9B (NM_001007537) Human Over-expression Lysate

Sign In for Pricing
View Details
Cobl Mouse Gene Knockout Kit (CRISPR)
KN503601 1 Kit

Cobl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE2D1 (NM_001204880) Human Tagged ORF Clone
RG235679 10 µg

UBE2D1 (NM_001204880) Human Tagged ORF Clone

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6502
BIGP-6502 1 Unit

General Purpose Incubator BIGP-6502

Sign In for Pricing
View Details