Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm28 Rabbit Polyclonal Antibody (HRP)

Rbm28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI503051, 2810480G15Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rbm28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

AAH18373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAX Mouse Monoclonal Antibody [Clone ID: OTI2A1]
CF810334 100 µg

BAX Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details
Human KASH5 activation kit by CRISPRa
GA115635 1 Kit

Human KASH5 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Adiponectin Receptor 1 (ADIPOR1) ELISA Kit
RDR-ADIPOR1-Mu-01 96 Tests

Mouse Adiponectin Receptor 1 (ADIPOR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Adiponectin Receptor 1 (ADIPOR1) ELISA Kit
RDR-ADIPOR1-Mu-02 48 Tests

Mouse Adiponectin Receptor 1 (ADIPOR1) ELISA Kit

Sign In for Pricing
View Details
POLDIP1 (KCTD13) Mouse Monoclonal Antibody [Clone ID: OTI3B12]
CF808801 100 µg

POLDIP1 (KCTD13) Mouse Monoclonal Antibody [Clone ID: OTI3B12]

Sign In for Pricing
View Details
GTSF1 (Center) Rabbit Polyclonal Antibody
AP51982PU-N 400 µL

GTSF1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details