Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm28 Rabbit Polyclonal Antibody (HRP)

Rbm28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI503051, 2810480G15Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rbm28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

AAH18373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX6 Polyclonal Antibody
E-AB-19196-01 20 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
E-AB-19196-02 60 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
E-AB-19196-03 120 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
E-AB-19196-04 200 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
Maleimide Coated - 96 well Solid plates - White PS
MCW22F-MAL 10x 96 Well Plates

Maleimide Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
Endothelin 1 (EDN1) (NM_001168319) Human Over-expression Lysate
LC432690 20 µg

Endothelin 1 (EDN1) (NM_001168319) Human Over-expression Lysate

Sign In for Pricing
View Details