Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRBD1 Rabbit Polyclonal Antibody (HRP)

SRBD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N5C6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRBD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFLSSIG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLS Lab Pro S6000 Recirculating Chiller with P17 Pump 380-420V 50/60Hz Three Phase
SLS1107 1 Each

SLS Lab Pro S6000 Recirculating Chiller with P17 Pump 380-420V 50/60Hz Three Phase

Sign In for Pricing
View Details
Recombinant Human RBP2 Protein, Tag free
YHE74302 100 μg

Recombinant Human RBP2 Protein, Tag free

Sign In for Pricing
View Details
LOXL4 Rabbit Polyclonal Antibody
orb667183-01 30 µL

LOXL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOXL4 Rabbit Polyclonal Antibody
orb667183-02 50 μL

LOXL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOXL4 Rabbit Polyclonal Antibody
orb667183-03 100 µL

LOXL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOXL4 Rabbit Polyclonal Antibody
orb667183-04 200 µL

LOXL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details