Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRBD1 Rabbit Polyclonal Antibody (HRP)

SRBD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ10379

UniProt

Q8N5C6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SRBD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

112kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_060549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Serpina1b shRNA (UAS) - Lentiviral mouseSerpina1b shRNA (UAS, GFP) (25)
GTR15203360 1 Vial

Lentiviral mouse Serpina1b shRNA (UAS) - Lentiviral mouseSerpina1b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CD45RA (B220, CD45R, GP180, Leukocyte common antigen, LCA, Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C, PTPRC, Receptor-type tyrosine-Protein phosphatase C, T200 GlycoProtein) (BSA & Azide Free) (MaxLight 550)
MBS6215299-01 0.1 mL

CD45RA (B220, CD45R, GP180, Leukocyte common antigen, LCA, Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C, PTPRC, Receptor-type tyrosine-Protein phosphatase C, T200 GlycoProtein) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
CD45RA (B220, CD45R, GP180, Leukocyte common antigen, LCA, Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C, PTPRC, Receptor-type tyrosine-Protein phosphatase C, T200 GlycoProtein) (BSA & Azide Free) (MaxLight 550)
MBS6215299-02 5x 0.1 mL

CD45RA (B220, CD45R, GP180, Leukocyte common antigen, LCA, Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C, PTPRC, Receptor-type tyrosine-Protein phosphatase C, T200 GlycoProtein) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
(2R,3R) -3-Amino-2-hydroxy-4-phenylbutyric acid ≥95% (HPLC)
231109-01 25 mg

(2R,3R) -3-Amino-2-hydroxy-4-phenylbutyric acid ≥95% (HPLC)

Sign In for Pricing
View Details
(2R,3R) -3-Amino-2-hydroxy-4-phenylbutyric acid ≥95% (HPLC)
231109-02 100 mg

(2R,3R) -3-Amino-2-hydroxy-4-phenylbutyric acid ≥95% (HPLC)

Sign In for Pricing
View Details
(2R,3R) -3-Amino-2-hydroxy-4-phenylbutyric acid ≥95% (HPLC)
231109-03 250 mg

(2R,3R) -3-Amino-2-hydroxy-4-phenylbutyric acid ≥95% (HPLC)

Sign In for Pricing
View Details