Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAVER2 Rabbit Polyclonal Antibody (Biotin)

RAVER2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZp762D1011, FLJ10770, KIAA1579

UniProt

Q9HCJ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAVER2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060681

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRASP65 Recombinant Antibody, Cy3 Conjugated
bsm-61876R-Cy3-01 20 µL

GRASP65 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
GRASP65 Recombinant Antibody, Cy3 Conjugated
bsm-61876R-Cy3-02 100 µL

GRASP65 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Dystrobrevin alpha Rabbit Polyclonal Antibody (Biotin)
orb453530 100 µL

Dystrobrevin alpha Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MAGI3 (Membrane-Associated Guanylate Kinase, WW and PDZ Domain-Containing Protein 3, Membrane-Associated Guanylate Kinase inverted 3, MAGI-3, MAGI3, KIAA1634) (PE)
MBS6457107-01 0.1 mL

MAGI3 (Membrane-Associated Guanylate Kinase, WW and PDZ Domain-Containing Protein 3, Membrane-Associated Guanylate Kinase inverted 3, MAGI-3, MAGI3, KIAA1634) (PE)

Sign In for Pricing
View Details
MAGI3 (Membrane-Associated Guanylate Kinase, WW and PDZ Domain-Containing Protein 3, Membrane-Associated Guanylate Kinase inverted 3, MAGI-3, MAGI3, KIAA1634) (PE)
MBS6457107-02 5x 0.1 mL

MAGI3 (Membrane-Associated Guanylate Kinase, WW and PDZ Domain-Containing Protein 3, Membrane-Associated Guanylate Kinase inverted 3, MAGI-3, MAGI3, KIAA1634) (PE)

Sign In for Pricing
View Details
BOC (N) Antibody, Rabbit Polyclonal
orb387713 100 µL

BOC (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details