Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAVER2 Rabbit Polyclonal Antibody (HRP)

RAVER2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp762D1011, FLJ10770, KIAA1579

UniProt

Q9HCJ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAVER2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060681

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-RYR2 (Ser2808) Antibody
AF7454-01 100 µL

Phospho-RYR2 (Ser2808) Antibody

Sign In for Pricing
View Details
Phospho-RYR2 (Ser2808) Antibody
AF7454-02 200 µL

Phospho-RYR2 (Ser2808) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pnma2 shRNA (UAS) - Lentiviral mouse Pnma2 shRNA (UAS, RFP) plasmid
GTR15288913 1 Vial

Lentiviral mouse Pnma2 shRNA (UAS) - Lentiviral mouse Pnma2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TRIM55 (Tripartite Motif-Containing Protein 55, Muscle-specific RING Finger Protein 2, MuRF-2, MuRF2, RING Finger Protein 29, TRIM55, MURF2, RNF29) (MaxLight 490) discontinued
302811-ML490 100 µL

TRIM55 (Tripartite Motif-Containing Protein 55, Muscle-specific RING Finger Protein 2, MuRF-2, MuRF2, RING Finger Protein 29, TRIM55, MURF2, RNF29) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rebaudioside M
orb1220785-01 200 mg

Rebaudioside M

Sign In for Pricing
View Details
Rebaudioside M
orb1220785-02 500 mg

Rebaudioside M

Sign In for Pricing
View Details