Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM63B Rabbit Polyclonal Antibody (Biotin)

TMEM63B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C6orf110

UniProt

Q5T3F8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM63B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphB2 (Ephrin Type-B Receptor 2, DRT, EPH-like Kinase 5, EK5, hEK5, ERK, Renal Carcinoma Antigen NY-REN-47, Tyrosine-protein Kinase TYRO5, Tyrosine-protein Kinase Receptor EPH-3, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (MaxLight 550)
126388-ML550 100 µL

EphB2 (Ephrin Type-B Receptor 2, DRT, EPH-like Kinase 5, EK5, hEK5, ERK, Renal Carcinoma Antigen NY-REN-47, Tyrosine-protein Kinase TYRO5, Tyrosine-protein Kinase Receptor EPH-3, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (MaxLight 550)

Sign In for Pricing
View Details
HCV Monoclonal Antibody
VAnt-Wyb114 Each

HCV Monoclonal Antibody

Sign In for Pricing
View Details
LOC685964 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV644927 1.0 µg DNA

LOC685964 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
DNAJC15 Rabbit Polyclonal Antibody (BF555)
orb2402321 100 µL

DNAJC15 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Multiplex Assay Kit for Endoglin (ENG), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027430 96 Tests

Multiplex Assay Kit for Endoglin (ENG), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
TMEM65 (FITC) discontinued
579442-01 50 µg

TMEM65 (FITC) discontinued

Sign In for Pricing
View Details