Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2BP1 Rabbit Polyclonal Antibody (HRP)

A2BP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2BP1, FOX1, A2BP1, FOX-1, HRNBP1

UniProt

Q9NWB1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human A2BP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT-4 (Neurotrophin 4) (FITC) discontinued
N6000-10A-FITC 100 µL

NT-4 (Neurotrophin 4) (FITC) discontinued

Sign In for Pricing
View Details
Cds2 Knockout HEK293T Polyclonal Cells
ARG4342 1 Million

Cds2 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Ciliary Neurotrophic Factor, Recombinant, Human (CNTF)
MBS650440-01 0.02 mg

Ciliary Neurotrophic Factor, Recombinant, Human (CNTF)

Sign In for Pricing
View Details
Ciliary Neurotrophic Factor, Recombinant, Human (CNTF)
MBS650440-02 5x 0.02 mg

Ciliary Neurotrophic Factor, Recombinant, Human (CNTF)

Sign In for Pricing
View Details
SCI100VC Benchtop Vacuum Controller, 100-230, 50/60Hz, US Plug
60311003009-01 1 Each

SCI100VC Benchtop Vacuum Controller, 100-230, 50/60Hz, US Plug

Sign In for Pricing
View Details
CCL7 3'UTR GFP Stable Cell Line
TU053755 1.0 mL

CCL7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details