Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZAP1 Rabbit Polyclonal Antibody (HRP)

DAZAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96EP5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_061832

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Programmed Cell Death Protein 1 Ligand 1
549470 200 µL

Programmed Cell Death Protein 1 Ligand 1

Sign In for Pricing
View Details
Chicken Dipeptidyl Peptidase IV ELISA kit
GTR10458316 96 Well

Chicken Dipeptidyl Peptidase IV ELISA kit

Sign In for Pricing
View Details
Recombinant Cowpea chlorotic mottle virus Replication protein 1a (ORF1a), partial
MBS1107084 Inquire

Recombinant Cowpea chlorotic mottle virus Replication protein 1a (ORF1a), partial

Sign In for Pricing
View Details
MFAP2 ORF Vector (Human) (pORF)
ORF006410 1.0 µg DNA

MFAP2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human CALCRL Protein, N-His
YHH31001 100 μg

Recombinant Human CALCRL Protein, N-His

Sign In for Pricing
View Details
RPMI 1640 with L-Gln and HEPES, liquid
30263-95 500 mL

RPMI 1640 with L-Gln and HEPES, liquid

Sign In for Pricing
View Details