Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZAP1 Rabbit Polyclonal Antibody (HRP)

DAZAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96EP5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_061832

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PU.1/Spi1 Rabbit Polyclonal Antibody (HRP)
orb473747 100 µL

PU.1/Spi1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
eIF3η Lentiviral Activation Particles (h)
sc-400817-LAC 200 µL

eIF3η Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Porcine Testican 2 ELISA Kit
MBS052204-01 48 Well

Porcine Testican 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Testican 2 ELISA Kit
MBS052204-02 96 Well

Porcine Testican 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Testican 2 ELISA Kit
MBS052204-03 5x 96 Well

Porcine Testican 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Testican 2 ELISA Kit
MBS052204-04 10x 96 Well

Porcine Testican 2 ELISA Kit

Sign In for Pricing
View Details