Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRN1 Rabbit Polyclonal Antibody (HRP)

XRN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

45170

UniProt

Q8IZH2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human XRN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

194kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_061874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Glycoprotein hormones alpha chain (Cga) ELISA
KLM5351 1x 96 Well

GENLISA™ Mouse Glycoprotein hormones alpha chain (Cga) ELISA

Sign In for Pricing
View Details
Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5
MBS140314-01 0.005 mg

Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5

Sign In for Pricing
View Details
Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5
MBS140314-02 0.02 mg

Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5

Sign In for Pricing
View Details
Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5
MBS140314-03 0.1 mg

Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5

Sign In for Pricing
View Details
Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5
MBS140314-04 5x 0.1 mg

Mouse Anti Human Serpin Peptidase Inhibitor, Clade B Member 5

Sign In for Pricing
View Details
Anti-Casein Kinase 2 beta (Rabbit, Monoclonal)
A109953 100 µL

Anti-Casein Kinase 2 beta (Rabbit, Monoclonal)

Sign In for Pricing
View Details