Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC5 Rabbit Polyclonal Antibody (Biotin)

EXOSC5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P12B, RRP46, RRP41B, Rrp46p, hRrp46p

UniProt

Q9NQT4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EXOS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKAT

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)
306995-01 50 µg

GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)

Sign In for Pricing
View Details
GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)
306995-02 100 µg

GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)

Sign In for Pricing
View Details
NOP19 Antibody
orb848248 2 mg

NOP19 Antibody

Sign In for Pricing
View Details
Anti-TRAF1 Antibody Picoband®, Dylight550 Conjugate
PA2006-Dylight550 100 µg

Anti-TRAF1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
DR5 Rabbit Polyclonal Antibody (APC-Cy7)
orb1597888 100 µL

DR5 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PPFIBP1 Rabbit Polyclonal Antibody
orb214791-01 30 µL

PPFIBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details