Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mbnl2 Rabbit Polyclonal Antibody (Biotin)

Mbnl2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

F2Z3T4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RAT Mbnl2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STAT3 Protein, His-SUMO, E.coli-10ug
QP6735-ec-10ug 10ug

Recombinant Human STAT3 Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
Gm9 Recombinant Protein (Mouse)
RP138737 100 µg

Gm9 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
C19orf28 (MFSD12) Human shRNA Plasmid Kit (Locus ID 126321)
TR306072 1 Kit

C19orf28 (MFSD12) Human shRNA Plasmid Kit (Locus ID 126321)

Sign In for Pricing
View Details
Mouse Monoclonal NPM1 Antibody (NPM1/3285) [Alexa Fluor 594]
NBP3-08745AF594 100 µL

Mouse Monoclonal NPM1 Antibody (NPM1/3285) [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Mesobuthus martensii Potassium channel toxin alpha-KTx 15.2
MBS7092849-01 0.02 mg (E-Coli)

Recombinant Mesobuthus martensii Potassium channel toxin alpha-KTx 15.2

Sign In for Pricing
View Details
Recombinant Mesobuthus martensii Potassium channel toxin alpha-KTx 15.2
MBS7092849-02 0.1 mg (E-Coli)

Recombinant Mesobuthus martensii Potassium channel toxin alpha-KTx 15.2

Sign In for Pricing
View Details