Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mbnl2 Rabbit Polyclonal Antibody (Biotin)

Mbnl2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

F2Z3T4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RAT Mbnl2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal anti-Human CXCL6 (GCP-2)
hAP-5824 50 µg

Sheep Polyclonal anti-Human CXCL6 (GCP-2)

Sign In for Pricing
View Details
Gpr161 siRNA Oligos set (Mouse)
22526174 3x 5 nmol

Gpr161 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Sheep UL16 Binding protein 2 ELISA kit
GTR10433048 96 Well

Sheep UL16 Binding protein 2 ELISA kit

Sign In for Pricing
View Details
Anti-RPS3 Antibody Picoband®, Cy3 Conjugate
A01542-2-Cy3 100 µg/Vial

Anti-RPS3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)
MBS6502320-01 0.2 mL

TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)

Sign In for Pricing
View Details
TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)
MBS6502320-02 5x 0.2 mL

TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)

Sign In for Pricing
View Details