Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sugp1 Rabbit Polyclonal Antibody (HRP)

Sugp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sf, Sf4, 5730496N02Rik

UniProt

Q8CH02

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NYSHAKQLPVAHRPSVFQSPDDDEEEDYEQWLEIKVSPPEGAETRRVIEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081757

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Hydroxy-2-naphthaleneacetic Acid
TRC-H948520-250MG 250 mg

6-Hydroxy-2-naphthaleneacetic Acid

Sign In for Pricing
View Details
Rabbit cAMP responsive element modulator (CREM) ELISA Kit
GTR10320291 96 Well

Rabbit cAMP responsive element modulator (CREM) ELISA Kit

Sign In for Pricing
View Details
CAPN2 Polyclonal Antibody, Biotin Conjugated
A57052-050 50 µL

CAPN2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human Mucolipin-3, MCOLN3 ELISA KIT
ELI-16342h 96 Tests

Human Mucolipin-3, MCOLN3 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8 Antibody (KRT8/803) [Janelia Fluor 549]
NBP3-11422JF549 0.1 mL

Mouse Monoclonal Cytokeratin 8 Antibody (KRT8/803) [Janelia Fluor 549]

Sign In for Pricing
View Details
Lentiviral human PGLYRP3 shRNA (UAS) - Lentiviral human PGLYRP3 shRNA (UAS, RFP) plasmid
GTR15086353 1 Vial

Lentiviral human PGLYRP3 shRNA (UAS) - Lentiviral human PGLYRP3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details