Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFSD Rabbit Polyclonal Antibody (FITC)

MTHFSD Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H954

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFSD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_073601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chemokine Receptor D6 (ACKR2) (NM_001296) Human Tagged Lenti ORF Clone
RC202459L3 10 µg

Chemokine Receptor D6 (ACKR2) (NM_001296) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human ANKEF1 shRNA (UAS) - Lentiviral human ANKEF1 shRNA (UAS, iRFP) (25)
GTR15298817 1 Vial

Lentiviral human ANKEF1 shRNA (UAS) - Lentiviral human ANKEF1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse Prkg2 (NM_008926) AAV Particle
MR225140A1V 250 µL

Mouse Prkg2 (NM_008926) AAV Particle

Sign In for Pricing
View Details
Human Integrin alpha L/CD11a MAb (Clone CR38)
MAB35951-SP 25 µg

Human Integrin alpha L/CD11a MAb (Clone CR38)

Sign In for Pricing
View Details
PPIAL4E Lentiviral Activation Particles (h2)
sc-417944-LAC-2 200 µL

PPIAL4E Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Human MIP3b (Macrophage Inflammatory Protein 3 Beta) Microsample ELISA Kit
orb2998883-01 48 Tests

Human MIP3b (Macrophage Inflammatory Protein 3 Beta) Microsample ELISA Kit

Sign In for Pricing
View Details