Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFSD Rabbit Polyclonal Antibody (FITC)

MTHFSD Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H954

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFSD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_073601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain substrate
orb2566682-01 10 mg

Calpain substrate

Sign In for Pricing
View Details
Calpain substrate
orb2566682-02 50 mg

Calpain substrate

Sign In for Pricing
View Details
Rabbit Polyclonal ABCG8 Antibody [HRP]
NB400-110H 0.1 mL

Rabbit Polyclonal ABCG8 Antibody [HRP]

Sign In for Pricing
View Details
C3orf34 CRISPR Activation Plasmid (h)
sc-413752-ACT 20 µg

C3orf34 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
UBE2L3 (Ubiquitin-conjugating Enzyme E2 L3, L-UBC, UBCE7, UbcH7, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2-F1, Ubiquitin-protein Ligase L3) (MaxLight 405)
MBS6193286-01 0.1 mL

UBE2L3 (Ubiquitin-conjugating Enzyme E2 L3, L-UBC, UBCE7, UbcH7, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2-F1, Ubiquitin-protein Ligase L3) (MaxLight 405)

Sign In for Pricing
View Details
UBE2L3 (Ubiquitin-conjugating Enzyme E2 L3, L-UBC, UBCE7, UbcH7, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2-F1, Ubiquitin-protein Ligase L3) (MaxLight 405)
MBS6193286-02 5x 0.1 mL

UBE2L3 (Ubiquitin-conjugating Enzyme E2 L3, L-UBC, UBCE7, UbcH7, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2-F1, Ubiquitin-protein Ligase L3) (MaxLight 405)

Sign In for Pricing
View Details