Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFSD Rabbit Polyclonal Antibody (HRP)

MTHFSD Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H954

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFSD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_073601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit
MBS9901360-01 48 Well

Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit

Sign In for Pricing
View Details
Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit
MBS9901360-02 96 Well

Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit

Sign In for Pricing
View Details
Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit
MBS9901360-03 5x 96 Well

Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit

Sign In for Pricing
View Details
Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit
MBS9901360-04 10x 96 Well

Horse SAM and SH3 Domain-Containing Protein 1 (SASH1) ELISA Kit

Sign In for Pricing
View Details
Mouse Fyn, clone FYN-1 (Monoclonal) Antibody
orb302569 0.1 mg

Mouse Fyn, clone FYN-1 (Monoclonal) Antibody

Sign In for Pricing
View Details
COD2 3'UTR GFP Stable Cell Line
TU054741 1.0 mL

COD2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details