Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFSD Rabbit Polyclonal Antibody (Biotin)

MTHFSD Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ12998, FLJ13893, MGC138262, MGC138264

UniProt

B7ZLC0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFSD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAC1 (ED29, Zinc Phosphodiesterase ELAC Protein 1, Deleted in Ma29, ElaC Homolog Protein 1, Ribonuclease Z 1, tRNA 3 Endonuclease 1, tRNase Z 1) (AP)
MBS6377184-01 0.1 mL

ELAC1 (ED29, Zinc Phosphodiesterase ELAC Protein 1, Deleted in Ma29, ElaC Homolog Protein 1, Ribonuclease Z 1, tRNA 3 Endonuclease 1, tRNase Z 1) (AP)

Sign In for Pricing
View Details
ELAC1 (ED29, Zinc Phosphodiesterase ELAC Protein 1, Deleted in Ma29, ElaC Homolog Protein 1, Ribonuclease Z 1, tRNA 3 Endonuclease 1, tRNase Z 1) (AP)
MBS6377184-02 5x 0.1 mL

ELAC1 (ED29, Zinc Phosphodiesterase ELAC Protein 1, Deleted in Ma29, ElaC Homolog Protein 1, Ribonuclease Z 1, tRNA 3 Endonuclease 1, tRNase Z 1) (AP)

Sign In for Pricing
View Details
SLC43A1 Protein Vector (Mouse) (pPM-C-HA)
PV230936 500 ng

SLC43A1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PCMV6-CDK5RAP2-3*FLAG
BZ65439 1 Vial

PCMV6-CDK5RAP2-3*FLAG

Sign In for Pricing
View Details
Lentiviral mouse Tbc1d32 shRNA (UAS) - Lentiviral mouse Tbc1d32 shRNA (UAS) plasmid
GTR15302134 1 Vial

Lentiviral mouse Tbc1d32 shRNA (UAS) - Lentiviral mouse Tbc1d32 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Research Grade Anti-SARS-CoV-2 RBD antibody (EY6A)
RVV00306 100 μg

Research Grade Anti-SARS-CoV-2 RBD antibody (EY6A)

Sign In for Pricing
View Details