Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFSD Rabbit Polyclonal Antibody (FITC)

MTHFSD Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ12998, FLJ13893, MGC138262, MGC138264

UniProt

B7ZLC0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFSD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYRK2 Antibody Blocking Peptide
orb1514238 500 µg

DYRK2 Antibody Blocking Peptide

Sign In for Pricing
View Details
Human recombinant TrkB protein
PROTQ16620-1-250ug 250 µg

Human recombinant TrkB protein

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)
MBS2045889-01 0.1 mL

FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)
MBS2045889-02 0.2 mL

FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)
MBS2045889-03 0.5 mL

FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)
MBS2045889-04 1 mL

FITC-Linked Polyclonal Antibody to Coagulation Factor V (F5)

Sign In for Pricing
View Details