Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL6 Rabbit Polyclonal Antibody (Biotin)

NOL6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NRAP, UTP22, bA311H10.1

UniProt

Q9H6R4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NOL6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH08298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DNAH10 Protein
E30P6762 20 µg

Recombinant Human DNAH10 Protein

Sign In for Pricing
View Details
ACAT2 (Acetyl-CoA Acetyltransferase, Cytosolic, Cytosolic Acetoacetyl-CoA Thiolase, Acetyl-CoA Transferase-like Protein, ACTL) (MaxLight 650)
MBS6220720-01 0.1 mL

ACAT2 (Acetyl-CoA Acetyltransferase, Cytosolic, Cytosolic Acetoacetyl-CoA Thiolase, Acetyl-CoA Transferase-like Protein, ACTL) (MaxLight 650)

Sign In for Pricing
View Details
ACAT2 (Acetyl-CoA Acetyltransferase, Cytosolic, Cytosolic Acetoacetyl-CoA Thiolase, Acetyl-CoA Transferase-like Protein, ACTL) (MaxLight 650)
MBS6220720-02 5x 0.1 mL

ACAT2 (Acetyl-CoA Acetyltransferase, Cytosolic, Cytosolic Acetoacetyl-CoA Thiolase, Acetyl-CoA Transferase-like Protein, ACTL) (MaxLight 650)

Sign In for Pricing
View Details
Human D Site Of Albumin Promoter Binding Protein (DBP) ELISA Kit
orb1662671-01 48 Tests

Human D Site Of Albumin Promoter Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
Human D Site Of Albumin Promoter Binding Protein (DBP) ELISA Kit
orb1662671-02 96 Tests

Human D Site Of Albumin Promoter Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
LexA Recombinant Protein
OPCA03516-1MG 1 mg

LexA Recombinant Protein

Sign In for Pricing
View Details