Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL6 Rabbit Polyclonal Antibody (HRP)

NOL6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NRAP, UTP22, bA311H10.1

UniProt

Q9H6R4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NOL6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH08298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Exosome component 5 Antibody [HRP]
NBP2-22241H 0.1 mL

Rabbit Polyclonal Exosome component 5 Antibody [HRP]

Sign In for Pricing
View Details
Anti-Fos B Rabbit pAb
GB11270 100 μL

Anti-Fos B Rabbit pAb

Sign In for Pricing
View Details
MRM1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
30424154 3x 1.0 µg DNA

MRM1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Furin Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV675582 1.0 µg DNA

Furin Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PRKCQ Antibody (Phospho-Ser676)
OASG05927-100UL 100 µL

PRKCQ Antibody (Phospho-Ser676)

Sign In for Pricing
View Details
Phospho-CD244 (Tyr271) Rabbit Polyclonal Antibody (PE-Cy7)
orb897669 100 µL

Phospho-CD244 (Tyr271) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details