Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM121B Rabbit Polyclonal Antibody (Biotin)

FAM121B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MIC26, Mic23, My025, FAM121B, MICOS26

UniProt

Q9BUR5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM121B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_077027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FRS2 shRNA (UAS) - Lentiviral human FRS2 shRNA (UAS, GFP) plasmid
GTR15153766 1 Vial

Lentiviral human FRS2 shRNA (UAS) - Lentiviral human FRS2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Biotin-Linked Anti-Sirtuin 1 (SIRT1)
FY-AB42231-01 1 mL

Biotin-Linked Anti-Sirtuin 1 (SIRT1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Sirtuin 1 (SIRT1)
FY-AB42231-02 100 µL

Biotin-Linked Anti-Sirtuin 1 (SIRT1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Sirtuin 1 (SIRT1)
FY-AB42231-03 200 µL

Biotin-Linked Anti-Sirtuin 1 (SIRT1)

Sign In for Pricing
View Details
VLDL Receptor Polyclonal Antibody, APC-Cy7 Conjugated
bs-21401R-APC-Cy7 100 µL

VLDL Receptor Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Actn1 / Alpha-actinin-1 Recombinant Protein
R0376m 1 Each

Mouse Actn1 / Alpha-actinin-1 Recombinant Protein

Sign In for Pricing
View Details