Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM121B Rabbit Polyclonal Antibody (HRP)

FAM121B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIC26, Mic23, My025, FAM121B, MICOS26

UniProt

Q9BUR5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM121B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_077027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-(-)-Diisopropyl Tartrate
TRC-D459700-25G 25 g

D-(-)-Diisopropyl Tartrate

Sign In for Pricing
View Details
BrdU (Bromodeoxyuridine) (BRD469), 0.2mg/mL
BNUB0469-100 1x 100 µL

BrdU (Bromodeoxyuridine) (BRD469), 0.2mg/mL

Sign In for Pricing
View Details
Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit
E-BC-K097-S-01 50 Assays (48 samples)

Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit
E-BC-K097-S-02 100 Assays (96 samples)

Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymphoid tissue
CP565806 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details
Human TOM1L2 activation kit by CRISPRa
GA115570 1 Kit

Human TOM1L2 activation kit by CRISPRa

Sign In for Pricing
View Details