Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRM1 Rabbit Polyclonal Antibody (HRP)

MRM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6IN84

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MRM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH09416

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pqlc3 (NM_172574) Mouse Tagged ORF Clone
MG202085 10 µg

Pqlc3 (NM_172574) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human IL-2 Recombinant Rabbit Monoclonal Antibody [PSH01-42] - BSA and Azide free (Capture)
HA721680 100 µL

Human IL-2 Recombinant Rabbit Monoclonal Antibody [PSH01-42] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Syntaxin 6 (STX6) Rabbit Polyclonal Antibody
TA366455 100 µL

Syntaxin 6 (STX6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details