Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX1 Rabbit Polyclonal Antibody (FITC)

SNX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VPS5, HsT17379

UniProt

Q13596

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_683758

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,7-Dihydroxy-5-cholestenoic acid
FD61616-01 1 mg

3,7-Dihydroxy-5-cholestenoic acid

Sign In for Pricing
View Details
3,7-Dihydroxy-5-cholestenoic acid
FD61616-02 2 mg

3,7-Dihydroxy-5-cholestenoic acid

Sign In for Pricing
View Details
Lentiviral mouse Hnf1a shRNA (UAS) - Lentiviral mouse Hnf1a shRNA (UAS, RFP) plasmid
GTR15257881 1 Vial

Lentiviral mouse Hnf1a shRNA (UAS) - Lentiviral mouse Hnf1a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DNAJC24, ID (DNAJC24, DPH4, ZCSL3, DnaJ homolog subfamily C member 24, CSL-type zinc finger-containing protein 3, DPH4 homolog) (PE)
MBS6292805-01 0.2 mL

DNAJC24, ID (DNAJC24, DPH4, ZCSL3, DnaJ homolog subfamily C member 24, CSL-type zinc finger-containing protein 3, DPH4 homolog) (PE)

Sign In for Pricing
View Details
DNAJC24, ID (DNAJC24, DPH4, ZCSL3, DnaJ homolog subfamily C member 24, CSL-type zinc finger-containing protein 3, DPH4 homolog) (PE)
MBS6292805-02 5x 0.2 mL

DNAJC24, ID (DNAJC24, DPH4, ZCSL3, DnaJ homolog subfamily C member 24, CSL-type zinc finger-containing protein 3, DPH4 homolog) (PE)

Sign In for Pricing
View Details
Recombinant Rat C-10 (CCL6)
MBS145325-01 0.002 mg

Recombinant Rat C-10 (CCL6)

Sign In for Pricing
View Details