Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX17 Rabbit Polyclonal Antibody (HRP)

DDX17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P72, RH70

UniProt

Q92841

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

EAW60248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Matrix extracellular phosphoglycoprotein ELISA Kit
MBS723028-01 48 Well

Human Matrix extracellular phosphoglycoprotein ELISA Kit

Sign In for Pricing
View Details
Human Matrix extracellular phosphoglycoprotein ELISA Kit
MBS723028-02 96 Well

Human Matrix extracellular phosphoglycoprotein ELISA Kit

Sign In for Pricing
View Details
Human Matrix extracellular phosphoglycoprotein ELISA Kit
MBS723028-03 5x 96 Well

Human Matrix extracellular phosphoglycoprotein ELISA Kit

Sign In for Pricing
View Details
Human Matrix extracellular phosphoglycoprotein ELISA Kit
MBS723028-04 10x 96 Well

Human Matrix extracellular phosphoglycoprotein ELISA Kit

Sign In for Pricing
View Details
SLC38A2 Antibody Blocking peptide
orb1452766 500 µg

SLC38A2 Antibody Blocking peptide

Sign In for Pricing
View Details
Cspg5 (NM_013884) Mouse Untagged Clone
MC217783 10 µg

Cspg5 (NM_013884) Mouse Untagged Clone

Sign In for Pricing
View Details