Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKFZP564O0523 Rabbit Polyclonal Antibody (Biotin)

DKFZP564O0523 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C7orf64, HSPC304

UniProt

Q5RL73

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DKFZP564O0523

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL5C (NM_001143968) Human Over-expression Lysate
LY428431 100 µg

ARL5C (NM_001143968) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CTR1 | Constitutive triple response 1
AS16 3988 50 µg

Anti-CTR1 | Constitutive triple response 1

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL
BNC470733-500 1x 500 µL

TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FTSJ3 activation kit by CRISPRa
GA114639 1 Kit

Human FTSJ3 activation kit by CRISPRa

Sign In for Pricing
View Details
ATG16L2 Human Gene Knockout Kit (CRISPR)
KN419270 1 Kit

ATG16L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Green Fluorescent FAM-VAD-OPH I in vitro poly Caspase Apoptosis Detection Reagent
6354 4x 62.3 µg Vials

Green Fluorescent FAM-VAD-OPH I in vitro poly Caspase Apoptosis Detection Reagent

Sign In for Pricing
View Details