Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIFK Rabbit Polyclonal Antibody (Biotin)

NIFK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Nopp34, MKI67IP

UniProt

Q9BYG3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MKI67IP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (DO-1), CF640R conjugate, 0.1mg/mL
BNC401658-100 1x 100 µL

P53 Tumor Suppressor Protein (DO-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tuftelin 1 (TUFT1) (NM_001126337) Human Over-expression Lysate
LC426678 20 µg

Tuftelin 1 (TUFT1) (NM_001126337) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS632998 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B6]
TA501601BM 100 µL

Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B6]

Sign In for Pricing
View Details
IRF6 Human Knockdown Lysate
LY300212 100 µg

IRF6 Human Knockdown Lysate

Sign In for Pricing
View Details
Clk3 Mouse Gene Knockout Kit (CRISPR)
KN503471 1 Kit

Clk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details