Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXF5 Rabbit Polyclonal Antibody (HRP)

NXF5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H1B4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NXF5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_116564

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV664235 1.0 µg DNA

SLC7A9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Spartalizumab Biosimilar - Research Grade
ICH5881-10mg 10 mg (2x 5 mg)

Spartalizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Hmbox1 Antibody - C-terminal region : HRP (ARP33576_P050-HRP)
ARP33576_P050-HRP 100 µL

Hmbox1 Antibody - C-terminal region : HRP (ARP33576_P050-HRP)

Sign In for Pricing
View Details
DUSP5 Polyclonal Antibody, PE-Cy5 Conjugated
bs-13036R-PE-Cy5-TR 20 µL

DUSP5 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Anti-Neisseria meningitidis Cas9 Antibody APC Conjugated
DZ41715-APC 200 µL/Vial

Anti-Neisseria meningitidis Cas9 Antibody APC Conjugated

Sign In for Pricing
View Details
Human CPT2 (Carnitine Palmitoyltransferase 2, Mitochondrial) ELISA Kit
EK242716 96 Well

Human CPT2 (Carnitine Palmitoyltransferase 2, Mitochondrial) ELISA Kit

Sign In for Pricing
View Details