Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1 Rabbit Polyclonal Antibody (Biotin)

LARP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LARP, Lar1, Lhp1

UniProt

Q6PKG0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LARP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

116kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse AhR (Aryl Hydrocarbon Receptor) CLIA Kit
E-CL-M0117-01 24 Tests

Mouse AhR (Aryl Hydrocarbon Receptor) CLIA Kit

Sign In for Pricing
View Details
Mouse AhR (Aryl Hydrocarbon Receptor) CLIA Kit
E-CL-M0117-02 48 Tests

Mouse AhR (Aryl Hydrocarbon Receptor) CLIA Kit

Sign In for Pricing
View Details
Mouse AhR (Aryl Hydrocarbon Receptor) CLIA Kit
E-CL-M0117-03 96 Tests

Mouse AhR (Aryl Hydrocarbon Receptor) CLIA Kit

Sign In for Pricing
View Details
Integrin Linked Kinase (ILK) (NM_001014794) Human Recombinant Protein
TP320460M 100 µg

Integrin Linked Kinase (ILK) (NM_001014794) Human Recombinant Protein

Sign In for Pricing
View Details
Human SPATA13 activation kit by CRISPRa
GA116598 1 Kit

Human SPATA13 activation kit by CRISPRa

Sign In for Pricing
View Details
SQSTM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]
TA502131BM 100 µL

SQSTM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]

Sign In for Pricing
View Details