Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1 Rabbit Polyclonal Antibody (Biotin)

LARP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LARP, Lar1, Lhp1

UniProt

Q6PKG0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LARP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_291029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (FITC) discontinued
F4600-10F-FITC 100 µL

Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (FITC) discontinued

Sign In for Pricing
View Details
Human SLC5A5 Pre-designed siRNA Set A
SI015165A 1 Each

Human SLC5A5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PLS1 Rabbit Polyclonal Antibody (APC)
orb1001199 100 µL

PLS1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
STK38 Protein Vector (Rat) (pPM-C-HA)
PV308648 500 ng

STK38 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human Interleukin-25 ELISA Kit
MBS2884469-01 48 Well

Human Interleukin-25 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-25 ELISA Kit
MBS2884469-02 96 Well

Human Interleukin-25 ELISA Kit

Sign In for Pricing
View Details