Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1 Rabbit Polyclonal Antibody (Biotin)

LARP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LARP, Lar1, Lhp1

UniProt

Q6PKG0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LARP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_291029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF5q31, NT (AFF4, AF5Q31, MCEF, AF4/FMR2 family member 4, ALL1-fused gene from chromosome 5q31 protein, Major CDK9 elongation factor-associated protein) (MaxLight 490)
MBS6272042-01 0.1 mL

AF5q31, NT (AFF4, AF5Q31, MCEF, AF4/FMR2 family member 4, ALL1-fused gene from chromosome 5q31 protein, Major CDK9 elongation factor-associated protein) (MaxLight 490)

Sign In for Pricing
View Details
AF5q31, NT (AFF4, AF5Q31, MCEF, AF4/FMR2 family member 4, ALL1-fused gene from chromosome 5q31 protein, Major CDK9 elongation factor-associated protein) (MaxLight 490)
MBS6272042-02 5x 0.1 mL

AF5q31, NT (AFF4, AF5Q31, MCEF, AF4/FMR2 family member 4, ALL1-fused gene from chromosome 5q31 protein, Major CDK9 elongation factor-associated protein) (MaxLight 490)

Sign In for Pricing
View Details
N- (2-Methoxyethyl) thian-4-amine hydrochloride
IWB36641-01 250 mg

N- (2-Methoxyethyl) thian-4-amine hydrochloride

Sign In for Pricing
View Details
N- (2-Methoxyethyl) thian-4-amine hydrochloride
IWB36641-02 2.5 g

N- (2-Methoxyethyl) thian-4-amine hydrochloride

Sign In for Pricing
View Details
CRK ORF Vector (Human) (pORF)
ORF002679 1.0 µg DNA

CRK ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Histone H3 (MonoMethyl-R2) Rabbit Polyclonal Antibody
orb334710-01 30 µL

Histone H3 (MonoMethyl-R2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details