Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1 Rabbit Polyclonal Antibody (HRP)

LARP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LARP, Lar1, Lhp1

UniProt

Q6PKG0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LARP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_291029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antimony (III) ethoxide
IN1117-01 10 g

Antimony (III) ethoxide

Sign In for Pricing
View Details
Antimony (III) ethoxide
IN1117-02 50 g

Antimony (III) ethoxide

Sign In for Pricing
View Details
Adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-cAMPS), economy grade
MBS256448-01 5 µmol

Adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-cAMPS), economy grade

Sign In for Pricing
View Details
Adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-cAMPS), economy grade
MBS256448-02 5x 5 µmol

Adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-cAMPS), economy grade

Sign In for Pricing
View Details
HPV33 E7 Polyclonal Antibody, Cy5.5 Conjugated
bs-2969R-Cy5.5 100 µL

HPV33 E7 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Alpha Fetoprotein (AFP) Antibody
abx170458-01 100 µL

Alpha Fetoprotein (AFP) Antibody

Sign In for Pricing
View Details