Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC6 Rabbit Polyclonal Antibody (Biotin)

EXOSC6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P11, EAP4, MTR3, Mtr3p, hMtr3p

UniProt

Q5RKV6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_478126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER2-targeted peptide H6F
HY-P10792 1 Each

HER2-targeted peptide H6F

Sign In for Pricing
View Details
GL8D2, NT (GLT8D2, GALA4A, Glycosyltransferase 8 domain-containing protein 2) (MaxLight 405) discontinued
036065-ML405 100 µL

GL8D2, NT (GLT8D2, GALA4A, Glycosyltransferase 8 domain-containing protein 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Csf1r, CT (Csf1r, Csfmr, Fms, Macrophage colony-stimulating factor 1 receptor, CSF-1 receptor, Proto-oncogene c-Fms, CD115) (MaxLight 490) discontinued
034269-ML490 100 µL

Csf1r, CT (Csf1r, Csfmr, Fms, Macrophage colony-stimulating factor 1 receptor, CSF-1 receptor, Proto-oncogene c-Fms, CD115) (MaxLight 490) discontinued

Sign In for Pricing
View Details
GFP sdAb monoclonal camelid FluoTag-X4
N0304-AF647-L 200 µL

GFP sdAb monoclonal camelid FluoTag-X4

Sign In for Pricing
View Details
PC-1 CRISPR/Cas9 KO Plasmid (m)
sc-422179 20 µg

PC-1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Complete Medium for Mouse Cardiac Microvascular Endothelial Cells
abx704232-01 100 mL

Complete Medium for Mouse Cardiac Microvascular Endothelial Cells

Sign In for Pricing
View Details