Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRPPRC Rabbit Polyclonal Antibody (FITC)

LRPPRC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LSFC, GP130, LRP130, MC4DN5, CLONE-23970

UniProt

P42704

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPPRC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_573566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1 (KBF1, NF-kappaB, NFkappaB, NF-kB1, NFKB-p50, EBP-1, p50, p105, TRANSCRIPTION FACTOR NFKB1, DNA-binding factor KBF1, NFKB p50, INCLUDED, NFKB p105, INCLUDED, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 1) (Biotin)
MBS6404547-01 0.1 mL

NFKB1 (KBF1, NF-kappaB, NFkappaB, NF-kB1, NFKB-p50, EBP-1, p50, p105, TRANSCRIPTION FACTOR NFKB1, DNA-binding factor KBF1, NFKB p50, INCLUDED, NFKB p105, INCLUDED, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 1) (Biotin)

Sign In for Pricing
View Details
NFKB1 (KBF1, NF-kappaB, NFkappaB, NF-kB1, NFKB-p50, EBP-1, p50, p105, TRANSCRIPTION FACTOR NFKB1, DNA-binding factor KBF1, NFKB p50, INCLUDED, NFKB p105, INCLUDED, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 1) (Biotin)
MBS6404547-02 5x 0.1 mL

NFKB1 (KBF1, NF-kappaB, NFkappaB, NF-kB1, NFKB-p50, EBP-1, p50, p105, TRANSCRIPTION FACTOR NFKB1, DNA-binding factor KBF1, NFKB p50, INCLUDED, NFKB p105, INCLUDED, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 1) (Biotin)

Sign In for Pricing
View Details
COIL Antibody Blocking peptide
orb1455682 500 µg

COIL Antibody Blocking peptide

Sign In for Pricing
View Details
SOX9 Antibody
orb2642611 100 µg

SOX9 Antibody

Sign In for Pricing
View Details
PP5 Antibody
DF12706-01 100 µL

PP5 Antibody

Sign In for Pricing
View Details
PP5 Antibody
DF12706-02 200 µL

PP5 Antibody

Sign In for Pricing
View Details