Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRPPRC Rabbit Polyclonal Antibody (HRP)

LRPPRC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LSFC, GP130, LRP130, MC4DN5, CLONE-23970

UniProt

P42704

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPPRC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_573566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal OCT4 Antibody (OCT4/6847R) [Alexa Fluor 647]
NBP3-21058AF647 0.1 mL

Rabbit Monoclonal OCT4 Antibody (OCT4/6847R) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human Krueppel-like factor 4 (KLF4) ELISA Kit
EK10205 48 Tests

Human Krueppel-like factor 4 (KLF4) ELISA Kit

Sign In for Pricing
View Details
Phospho-NFATC4 (Ser168 + Ser170) Rabbit Polyclonal Antibody (BF594)
orb2382693 100 µL

Phospho-NFATC4 (Ser168 + Ser170) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Polyclonal GCNT3 Antibody (Internal)
APR16099G 0.05mg

Polyclonal GCNT3 Antibody (Internal)

Sign In for Pricing
View Details
OLFR155 Adenovirus (Mouse)
32939054 1.0 mL

OLFR155 Adenovirus (Mouse)

Sign In for Pricing
View Details
Rat H-FABP Matched Antibody Pair Set [ABP-S-03851]
ABP-S-03851 5 Plates

Rat H-FABP Matched Antibody Pair Set [ABP-S-03851]

Sign In for Pricing
View Details