Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRPPRC Rabbit Polyclonal Antibody (HRP)

LRPPRC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LSFC, GP130, LRP130, MC4DN5, CLONE-23970

UniProt

P42704

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPPRC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_573566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-1-2-as-5p miRNA Antagomir
MNM01138 2x 5.0 nmol

mmu-miR-1-2-as-5p miRNA Antagomir

Sign In for Pricing
View Details
CCDC81 Recombinant Protein (Mouse)
RP121928 100 µg

CCDC81 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Phospholipase A2 Receptor 1 Antibody / PLA2R1
V5700-100UG 100 µg

Phospholipase A2 Receptor 1 Antibody / PLA2R1

Sign In for Pricing
View Details
LARS2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV730842 1.0 µg DNA

LARS2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
HMGCS2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62355R-BF350 100 µL

HMGCS2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
HMGB4 Antibody - C-terminal region
ARP39852_P050-25UL 25 µL

HMGB4 Antibody - C-terminal region

Sign In for Pricing
View Details