Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSI2 Rabbit Polyclonal Antibody (HRP)

MSI2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSI2H

UniProt

Q96DH6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_620412

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA)
orb2922359-01 20 µg

Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA)
orb2922359-02 100 µg

Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA)

Sign In for Pricing
View Details
Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)
MBS1410381-01 0.02 mg (E-Coli)

Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)

Sign In for Pricing
View Details
Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)
MBS1410381-02 0.02 mg (Yeast)

Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)

Sign In for Pricing
View Details
Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)
MBS1410381-03 0.1 mg (E-Coli)

Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)

Sign In for Pricing
View Details
Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)
MBS1410381-04 0.1 mg (Yeast)

Recombinant Rat PTB domain-containing engulfment adapter protein 1 (Gulp1)

Sign In for Pricing
View Details