Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSI2 Rabbit Polyclonal Antibody (HRP)

MSI2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSI2H

UniProt

Q96DH6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_620412

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP4 ORF Vector (Human) (pORF)
12307011 1.0 µg DNA

ARHGAP4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Mouse anti-Rat IgM Heavy Chain Secondary Antibody (MARM-4) [Allophycocyanin]
NBP2-68381APC 0.25 mL

Mouse Monoclonal Mouse anti-Rat IgM Heavy Chain Secondary Antibody (MARM-4) [Allophycocyanin]

Sign In for Pricing
View Details
Junctional Adhesion Molecule 1 (JAM-1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (APC)
128699-APC 100 µL

Junctional Adhesion Molecule 1 (JAM-1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (APC)

Sign In for Pricing
View Details
Kinetochore (KNTC1) Human qPCR Primer Pair (NM_014708)
HP211089 200 Reactions

Kinetochore (KNTC1) Human qPCR Primer Pair (NM_014708)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C11orf74 (C11orf74)
MBS1297283-01 0.02 mg (E-Coli)

Recombinant Human Uncharacterized protein C11orf74 (C11orf74)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C11orf74 (C11orf74)
MBS1297283-02 0.1 mg (E-Coli)

Recombinant Human Uncharacterized protein C11orf74 (C11orf74)

Sign In for Pricing
View Details