Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT2 Rabbit Polyclonal Antibody (HRP)

ZMAT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Snu23, Ptg-12

UniProt

Q96NC0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZMAT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653324

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exosome derived from human B lymphocyte cell line (BC-3 )
Exo-IC01 1 Each

Exosome derived from human B lymphocyte cell line (BC-3 )

Sign In for Pricing
View Details
RGD1311558 AAV Vector (Rat) (CMV)
39140106 1 µg

RGD1311558 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
GGH (NM_003878) Human Recombinant Protein
TP302265 20 µg

GGH (NM_003878) Human Recombinant Protein

Sign In for Pricing
View Details
Olfr1303 AAV Vector (Mouse) (CMV)
32758104 1 µg

Olfr1303 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Guinea pig 26S proteasome non-ATPase regulatory subunit 7 (PSMD7) ELISA Kit
MBS7228360-01 48 Well

Guinea pig 26S proteasome non-ATPase regulatory subunit 7 (PSMD7) ELISA Kit

Sign In for Pricing
View Details
Guinea pig 26S proteasome non-ATPase regulatory subunit 7 (PSMD7) ELISA Kit
MBS7228360-02 96 Well

Guinea pig 26S proteasome non-ATPase regulatory subunit 7 (PSMD7) ELISA Kit

Sign In for Pricing
View Details