Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM11 Rabbit Polyclonal Antibody (FITC)

RBM11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P57052

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBM11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_658983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SELENBP1 Antibody, KO Validated
14-321 100 µL

SELENBP1 Antibody, KO Validated

Sign In for Pricing
View Details
Bovine Epididymis specific Alpha mannosidase (MAN2B2) ELISA Kit
GTR10320641 96 Well

Bovine Epididymis specific Alpha mannosidase (MAN2B2) ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal Anti-a-Lactalbumin Clone F20.16
TA353305L 500 µg

Mouse monoclonal Anti-a-Lactalbumin Clone F20.16

Sign In for Pricing
View Details
Box of 50 Quartz Microfibres Filter, 142 Mm
FQ30A0142L Box of 50

Box of 50 Quartz Microfibres Filter, 142 Mm

Sign In for Pricing
View Details
PROSER3 (Proline and Serine-Rich Protein 3, Proline and Serine-Rich 3)
489433 100 µL

PROSER3 (Proline and Serine-Rich Protein 3, Proline and Serine-Rich 3)

Sign In for Pricing
View Details
SPIB Rabbit Polyclonal Antibody (Biotin)
orb2143397 100 µL

SPIB Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details