Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RG9MTD3 Rabbit Polyclonal Antibody (HRP)

RG9MTD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RG9MTD3, bA3J10.9

UniProt

Q6PF06

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RG9MTD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Human Hif-1Α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
FY-EH2787S 96 Well

Easypro Human Hif-1Α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
NHERF-2 Antibody / SLC9A3R2
RQ7659 100 µg

NHERF-2 Antibody / SLC9A3R2

Sign In for Pricing
View Details
SYNJ2-IT1 Protein Vector (Human) (pPM-C-His)
PV134401 500 ng

SYNJ2-IT1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human LRRK2 Knockout Cell Line-HeLa
CSC-RT1698 > 10^6 Cells/Vial

Human LRRK2 Knockout Cell Line-HeLa

Sign In for Pricing
View Details
UBE2H Polyclonal Antibody
RA35806-01 50 µL

UBE2H Polyclonal Antibody

Sign In for Pricing
View Details
UBE2H Polyclonal Antibody
RA35806-02 100 µL

UBE2H Polyclonal Antibody

Sign In for Pricing
View Details