Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCP2 Rabbit Polyclonal Antibody (FITC)

DCP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NUDT20

UniProt

Q8IU60

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DCP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_689837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para
MBS6225826-01 0.1 mL

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para
MBS6225826-02 5x 0.1 mL

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para

Sign In for Pricing
View Details
Lentiviral human SPHK2 sgRNA gene knockout kit - Lentiviral human SPHK2 sgRNA gene knockout kit (plasmid)
GTR15377618 1 Vial

Lentiviral human SPHK2 sgRNA gene knockout kit - Lentiviral human SPHK2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Dog Interleukin 6, IL-6 ELISA Kit
CSB-E11260c-01 48 Tests

Dog Interleukin 6, IL-6 ELISA Kit

Sign In for Pricing
View Details
Dog Interleukin 6, IL-6 ELISA Kit
CSB-E11260c-02 96 Tests

Dog Interleukin 6, IL-6 ELISA Kit

Sign In for Pricing
View Details
Dog Interleukin 6, IL-6 ELISA Kit
CSB-E11260c-03 5x 96 Tests

Dog Interleukin 6, IL-6 ELISA Kit

Sign In for Pricing
View Details