Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRB1 Rabbit Polyclonal Antibody (HRP)

DRB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRB1, RB-1

UniProt

Q8IUH3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DRB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694453

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophosphamide discontinued
445354-01 100 mg

Cyclophosphamide discontinued

Sign In for Pricing
View Details
Cyclophosphamide discontinued
445354-02 250 mg

Cyclophosphamide discontinued

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transcription factor fapR (fapR)
MBS1084013-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Transcription factor fapR (fapR)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transcription factor fapR (fapR)
MBS1084013-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Transcription factor fapR (fapR)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transcription factor fapR (fapR)
MBS1084013-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Transcription factor fapR (fapR)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transcription factor fapR (fapR)
MBS1084013-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Transcription factor fapR (fapR)

Sign In for Pricing
View Details