Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEX1 Rabbit Polyclonal Antibody (Biotin)

THEX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HEXO, THEX1, 3'HEXO

UniProt

Q8IV48

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human THEX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC5L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0409405 3x 1.0 µg

CDC5L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)
MBS2098881-01 5x 96 Tests

Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)
MBS2098881-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)
MBS2098881-03 10x 96 Tests

Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)
MBS2098881-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Sex Hormone Binding Globulin (SHBG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
TBR1 Recombinant Antibody, FITC Conjugated
bsm-60877R-FITC-01 20 µL

TBR1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details