Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSI2 Rabbit Polyclonal Antibody (HRP)

MSI2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSI2H

UniProt

Q96DH6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MSI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_733839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BigLEN (mouse)
TP2073 1 mg

BigLEN (mouse)

Sign In for Pricing
View Details
Rpf2 3'UTR GFP Stable Cell Line
TU168062 1.0 mL

Rpf2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HDAC7A (Phospho-Ser155) Colorimetric Cell-Based ELISA Kit
EKC2638 1 Kit, Containing two 96 Well Plates and all necessary reagents

HDAC7A (Phospho-Ser155) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cinchonine (LA40221)
C08419 25 mg

Cinchonine (LA40221)

Sign In for Pricing
View Details
IKKB, Phosphorylated (S466) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (PE)
MBS6309683-01 0.2 mL

IKKB, Phosphorylated (S466) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (PE)

Sign In for Pricing
View Details
IKKB, Phosphorylated (S466) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (PE)
MBS6309683-02 5x 0.2 mL

IKKB, Phosphorylated (S466) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (PE)

Sign In for Pricing
View Details