Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALYL Rabbit Polyclonal Antibody (HRP)

RALYL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HNRPCL3

UniProt

Q86SE5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RALYL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_776247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydroevodiamine hydrochloride
C09646-5mg 5 mg

Dehydroevodiamine hydrochloride

Sign In for Pricing
View Details
S100A8 (S100 Calcium Binding Protein A8, 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8) (MaxLight 650)
MBS6229782-01 0.1 mL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8) (MaxLight 650)

Sign In for Pricing
View Details
S100A8 (S100 Calcium Binding Protein A8, 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8) (MaxLight 650)
MBS6229782-02 5x 0.1 mL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8) (MaxLight 650)

Sign In for Pricing
View Details
Anti-MCL1 Antibody Picoband® (Dylight550 Conjugate)
PB9132-Dylight550 100 µg

Anti-MCL1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
SNX16 (Sorting Nexin-16) (MaxLight 550)
133659-ML550 100 µL

SNX16 (Sorting Nexin-16) (MaxLight 550)

Sign In for Pricing
View Details
GEP100/IQSEC1 Polyclonal Antibody, Cy3 Conjugated
bs-13960R-Cy3 100 µL

GEP100/IQSEC1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details